3.40 Rating by CuteStat

vayanis.com is 2 decades 3 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, vayanis.com is SAFE to browse.

PageSpeed Score
36
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: 43
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 30,300
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 10 H2 Headings: Not Applicable
H3 Headings: 10 H4 Headings: 2
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 9
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.28.23.33)

Paul Irish

- paulirish.com
310,632 $ 28,620.00


سهامداران پدیده شاندیز و پدیده کیش

- shandizstocks.ir

سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند

30,640 $ 271,440.00

uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras

- uevf.org

Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat

Not Applicable $ 8.95

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

- centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 26 Dec 2019 06:19:27 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
x-amz-id-2: QhtumnoZg6dSg3GBaWpFrxExi/kByHdRysvoT2yf+zx0kE/NwXOaF0W6ALYXEtyfLkINuCR5hyo=
x-amz-request-id: 075A98C4238F945C
Last-Modified: Wed, 26 Apr 2017 06:20:36 GMT
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54b0f176cdf793ca-SJC
Content-Encoding: gzip

Domain Information

Domain Registrar: NAMECHEAP INC
Registration Date: Jan 23, 2004, 5:29 AM 2 decades 3 months 2 weeks ago
Expiration Date: Jan 23, 2021, 5:29 AM 3 years 3 months 3 weeks ago
Domain Status:
clienttransferprohibited
ok

Domain Nameserver Information

Host IP Address Country
hugh.ns.cloudflare.com 173.245.59.117 United States of America United States of America
dora.ns.cloudflare.com 173.245.58.108 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
vayanis.com A 300 IP: 104.28.23.33
vayanis.com A 300 IP: 104.28.22.33
vayanis.com NS 86400 Target: hugh.ns.cloudflare.com
vayanis.com NS 86400 Target: dora.ns.cloudflare.com
vayanis.com SOA 3600 MNAME: dora.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2031178698
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
vayanis.com MX 300 Priority: 10
Target: aspmx2.googlemail.com
vayanis.com MX 300 Priority: 10
Target: aspmx3.googlemail.com
vayanis.com MX 300 Priority: 1
Target: aspmx.l.google.com
vayanis.com MX 300 Priority: 5
Target: alt1.aspmx.l.google.com
vayanis.com MX 300 Priority: 5
Target: alt2.aspmx.l.google.com
vayanis.com AAAA 300 IPV6: 2606:4700:30::681c:1721
vayanis.com AAAA 300 IPV6: 2606:4700:30::681c:1621

Full WHOIS Lookup

Domain name: vayanis.com
Registry Domain ID: 110420933_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2018-01-11T11:25:07.00Z
Creation Date: 2004-01-22T23:44:58.00Z
Registrar Registration Expiration Date: 2021-01-22T23:44:58.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code: 0
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code: 0
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code: 0
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Name Server: dora.ns.cloudflare.com
Name Server: hugh.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-25T23:19:40.23Z <<<

For more information on Whois status codes, please visit https://icann.org/epp