Web Analysis for Vayanis - vayanis.com
3.40
Rating by CuteStat
vayanis.com is 2 decades 3 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, vayanis.com is SAFE to browse.
PageSpeed Score
36
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | 43 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 30,300 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 10 | H2 Headings: | Not Applicable |
H3 Headings: | 10 | H4 Headings: | 2 |
H5 Headings: | 1 | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 9 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.28.23.33)
Instagramers.com | Web for instagram addicts | Tips Apps iPhone Hipsta
- instagramers.com
1,023,359
$
1,200.00
سهامداران پدیده شاندیز و پدیده کیش
- shandizstocks.ir
سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند
30,640
$
271,440.00
uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras
- uevf.org
Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat
Not Applicable
$
8.95
Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100
- centralpennsylvaniatrafficlawyers.com
Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Thu, 26 Dec 2019 06:19:27 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
x-amz-id-2: QhtumnoZg6dSg3GBaWpFrxExi/kByHdRysvoT2yf+zx0kE/NwXOaF0W6ALYXEtyfLkINuCR5hyo=
x-amz-request-id: 075A98C4238F945C
Last-Modified: Wed, 26 Apr 2017 06:20:36 GMT
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54b0f176cdf793ca-SJC
Content-Encoding: gzip
Date: Thu, 26 Dec 2019 06:19:27 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
x-amz-id-2: QhtumnoZg6dSg3GBaWpFrxExi/kByHdRysvoT2yf+zx0kE/NwXOaF0W6ALYXEtyfLkINuCR5hyo=
x-amz-request-id: 075A98C4238F945C
Last-Modified: Wed, 26 Apr 2017 06:20:36 GMT
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54b0f176cdf793ca-SJC
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
hugh.ns.cloudflare.com | 173.245.59.117 | United States of America | |
dora.ns.cloudflare.com | 173.245.58.108 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
vayanis.com | A | 300 |
IP: 104.28.23.33 |
vayanis.com | A | 300 |
IP: 104.28.22.33 |
vayanis.com | NS | 86400 |
Target: hugh.ns.cloudflare.com |
vayanis.com | NS | 86400 |
Target: dora.ns.cloudflare.com |
vayanis.com | SOA | 3600 |
MNAME: dora.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2031178698 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
vayanis.com | MX | 300 |
Priority: 10 Target: aspmx2.googlemail.com |
vayanis.com | MX | 300 |
Priority: 10 Target: aspmx3.googlemail.com |
vayanis.com | MX | 300 |
Priority: 1 Target: aspmx.l.google.com |
vayanis.com | MX | 300 |
Priority: 5 Target: alt1.aspmx.l.google.com |
vayanis.com | MX | 300 |
Priority: 5 Target: alt2.aspmx.l.google.com |
vayanis.com | AAAA | 300 |
IPV6: 2606:4700:30::681c:1721 |
vayanis.com | AAAA | 300 |
IPV6: 2606:4700:30::681c:1621 |
Full WHOIS Lookup
Domain name: vayanis.com
Registry Domain ID: 110420933_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2018-01-11T11:25:07.00Z
Creation Date: 2004-01-22T23:44:58.00Z
Registrar Registration Expiration Date: 2021-01-22T23:44:58.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code: 0
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code: 0
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code: 0
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Name Server: dora.ns.cloudflare.com
Name Server: hugh.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-25T23:19:40.23Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registry Domain ID: 110420933_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2018-01-11T11:25:07.00Z
Creation Date: 2004-01-22T23:44:58.00Z
Registrar Registration Expiration Date: 2021-01-22T23:44:58.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code: 0
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code: 0
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code: 0
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: b75a73699ee04525bb625012a055fad0.protect@whoisguard.com
Name Server: dora.ns.cloudflare.com
Name Server: hugh.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-25T23:19:40.23Z <<<
For more information on Whois status codes, please visit https://icann.org/epp